PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00132.1_g00018.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 385aa    MW: 42361.8 Da    PI: 5.0849
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00132.1_g00018.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_146.95.8e-15192245356
                              XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                              ++k+ rr+ +NRe+ArrsR+RK++++  Le+ v eL++e ++L k+l++++ ++
  Rsa1.0_00132.1_g00018.1 192 DVKKSRRMLSNRESARRSRRRKQEQTCDLETQVNELKGEHSSLLKQLSNMNHKY 245
                              789*****************************************9888887766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003389.8E-19190254IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.2E-12191244No hitNo description
PROSITE profilePS5021710.944192246IPR004827Basic-leucine zipper domain
PfamPF001702.9E-14192246IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.61E-11193244No hitNo description
PROSITE patternPS000360197212IPR004827Basic-leucine zipper domain
PfamPF124981.1E-13261350IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0002240Biological Processresponse to molecule of oomycetes origin
GO:0009626Biological Processplant-type hypersensitive response
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000693Biological Processpositive regulation of seed maturation
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 385 aa     Download sequence    Send to blast
MNSIFSIDDF SDPFWESSPP LDSDSAKVVT ADEWTVEMFL EEIASSVSSE PVGNNNAIVG  60
VSSAQSLPSV SGQNDFEEDS RFRRDSDEYR RVLTSKLETE CATVVALRAG SVKPEDSTGS  120
PETLFQPAQS SPLTQGSLVT PGEVGVTSSL LAEVKKSGVP IKQVTSGSSR DYSDDDDLDE  180
ENETTGSLKP EDVKKSRRML SNRESARRSR RRKQEQTCDL ETQVNELKGE HSSLLKQLSN  240
MNHKYDDAAV GNRILKADIE TLRAKVKMAE ETVKRVTGMN PMLLGRSNGH SNNNRMPLTG  300
NSRMASSCLP PFQPQSNLNM GGLPTIPSPR LENSFIPTPS LNSQTNSHLQ RIRNTQTHHP  360
APTTNPYGWT TETQNDSAWP KKCVD
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1206213RRSRRRKQ
2208213SRRRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3535460.0AK353546.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-51-H19.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013611166.10.0PREDICTED: basic leucine zipper 10
SwissprotO227630.0BZP10_ARATH; Basic leucine zipper 10
TrEMBLA0A078GB210.0A0A078GB21_BRANA; BnaC09g00090D protein
STRINGBra036251.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM148711720
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02640.20.0bZIP family protein